Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDPLVPRGSPGEFTAKNSSKELPASESEVCIK TFKEQMRLELELPKLPGNRPTSPKISPRSSPRNSPCFFRKLLVNKSIRQR RRFTVAHTCFDVENGPSPGRSPLDPQASSSSGLVLHAAFPGHSQRRESFL YRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVRNNFTL LTNLHGAPNKRSPAASQAPVTRVSLQEESYQKLAMETLEELDWCLDQLET IQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQND VEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENE DHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFKISS DTFVTYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAVFTDLE ILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFK LLQEEHCDIFQNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVET KKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEE FFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQ PDAQDILDTLEDNRNWYQSMIPQSPSPPLDERSRDCQGLMEKFQFELTLE EEDSEGPEKEGEGPNYFSSTKTLCKPCHAANGLALPVGGGNAASTQPRCG HV
    • Molecular weight
      108 kDa including tags
    • Amino acids
      2 to 722
    • Tags
      GST tag N-Terminus
    • Additional sequence information
      (NM_017031)

Specifications

Our Abpromise guarantee covers the use of ab198434 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    15,345 pmole/min/µg. Assay Description: One unit is defined as the amount of enzyme that will convert 1 pmole of 3′, 5′-cAMP to 5′-AMP per min at 37°C. Assay conditions: 10 mM Tris-HCl, pH 7.4, 10 mM MgCl2, 0.1 mg/ml BSA, 0.05% Tween-20, 200 µM cAMP, and serial dilutions of rPDE4B at 37ºC for 20 min. Quantified by 5′ nucleotidase cleaving the 5′-AMP product and releasing the phosphate group which is detected by Malachite Green Reagent.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >= 70 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.64% Tris HCl, 0.64% Sodium chloride, 0.017% Potassium chloride, 0.04% Tween, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase 4B
    • cAMP-specific 3''
    • cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    • cAMP-specific phosphodiesterase-4 B isoform
    • DKFZp686F2182
    • DPDE4
    • dunce-like phosphodiesterase E4
    • MGC126529
    • OTTHUMP00000010652
    • OTTHUMP00000010653
    • OTTHUMP00000010654
    • OTTHUMP00000010656
    • OTTHUMP00000232365
    • PDE 4B
    • PDE IVB
    • PDE32
    • Pde4b
    • PDE4B_HUMAN
    • PDE4B5
    • PDEIVB
    • Phosphodiesterase 4B
    • Phosphodiesterase 4B cAMP specific
    • Phosphodiesterase 4B, cAMP specific (phosphodiesterase E4 dunce homolog, Drosophila)
    see all
  • Function
    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in mediating central nervous system effects of therapeutic agents ranging from antidepressants to antiasthmatic and anti-inflammatory agents.
  • Tissue specificity
    Expressed in brain, heart, lung and skeletal muscle.
  • Pathway
    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE4 subfamily.
  • Information by UniProt

Images

  • Activity assay of ab198434.

  • 4-20% SDS-PAGE analysis of 2 µg ab198434 with Coomassie staining.

References

ab198434 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198434.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up