Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      MLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRR FLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSL IAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRES GLFSHLPLESRHEMEAQIGALILATDISRQNEYLSLFRSHLDKGDLHLDD GRHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEFFHQGDIEKKYHL GVSPLCDRQTESIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHVGL NKASWKGLQRQQPSSEDASAAFELNSQLLTQENRLS
    • Molecular weight

      65 kDa including tags
    • Amino acids

      147 to 482
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: ≥354 pmol/min/µg.
    Unit Definition: One unit is defined as the amount of enzyme that will convert 1 pmole of 3', 5'-cAMP to 5'-AMP per minute at 37°C.
    Assay conditions: 10 mM Tris-HCl, pH 7.4, 10 mM MgCl2, 0.05% Tween-20, 0.1 mg/ml BSA, 200 µM cAMP, 2.5 kU 5'-nucleotidase, and serial dilutions of ab198419 at 37°C for 20 min. Quantified by 5'-nucleotidase cleaving the 5'-AMP product and releasing the phosphate group which is detected by Malachite Green Reagent.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    30 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as PDE7A

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 0.55% Glutathione, 10% Glycerol, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 5''-cyclic phosphodiesterase 7A
    • HCP 1
    • HCP1
    • High affinity cAMP specific 3'5' cyclic phosphodiesterase 7A
    • High affinity cAMP-specific 3''
    • P2A
    • PDE 7
    • PDE 7A
    • PDE1/PDE2 yeast human complement of
    • PDE7
    • PDE71
    • PDE7A
    • PDE7A_HUMAN
    • Phosphodiesterase 7A
    • Phosphodiesterase isozyme 7
    • Phosphodiesterase7A
    • Rolipram insensitive phosphodiesterase type 7
    • TM 22
    • TM22
    see all
  • Function

    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May have a role in muscle signal transduction.
  • Tissue specificity

    PDE7A1 is found at high levels in skeletal muscle and at low levels in a variety of tissues including brain and heart. It is expressed as well in two T-cell lines. PDE7A2 is found abundantly in skeletal muscle and at low levels in heart.
  • Pathway

    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
  • Sequence similarities

    Belongs to the cyclic nucleotide phosphodiesterase family. PDE7 subfamily.
  • Developmental stage

    Developmentally regulated. PDE7A1 and PDE7A2 are found in several fetal tissues, expression is reduced throughout development. It persists strongly only in adult skeletal muscle.
  • Domain

    Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.
  • Cellular localization

    Cytoplasm > cytosol. PDE7A1 (57 kDa) is located mostly to soluble cellular fractions and Cytoplasm. PDE7A2 (50 kDa) is located to particulate cellular fractions.
  • Information by UniProt

Images

  • Activity assay using ab198419.

  • 10% SDS-PAGE analysis of 5µg ab198419 with Coomassie staining.

References

ab198419 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198419.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up