Description

  • Product name

    Recombinant Rat Plasma Kallikrein 1B protein (His tag)
    See all Plasma Kallikrein 1B proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIP YPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQ TPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATI PLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRW QLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      391 to 638
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Plasma Kallikrein light chain.

Specifications

Our Abpromise guarantee covers the use of ab226435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Fletcher factor
    • kallikrein B plasma
    • Kallikrein B plasma (Fletcher factor) 1
    • Kallikrein B, plasma 1
    • Kallikrein B1
    • Kininogenin
    • KLK3
    • KLKB1
    • KLKB1_HUMAN
    • PKK
    • PKKD
    • Plasma kallikrein
    • Plasma kallikrein B1
    • Plasma kallikrein light chain
    • Plasma prekallikrein
    • PPK
    • Prekallikrein
    see all
  • Function

    The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.
  • Involvement in disease

    Defects in KLKB1 are the cause of prekallikrein deficiency (PKK deficiency) [MIM:612423]; also known as Fletcher factor deficiency. This disorder is a blood coagulation defect.
  • Sequence similarities

    Belongs to the peptidase S1 family. Plasma kallikrein subfamily.
    Contains 4 apple domains.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226435 with 5% enrichment gel and 15% separation gel.

References

ab226435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up