Description

  • Product name

    Recombinant Rat PLBD2 protein (Tagged)
    See all PLBD2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      GALPTLGPGWRRQNPEPPASRTRSLLLDAASGQLRLEYGFHPDAVAWANL TNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEASVSEELIYMHWMNTVV NYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLTLLQL KGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTNTKPSV GSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEY PLIAGNNLIFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQP QGCVLEWIRNIVANRLALDGATWADVFRRFNSGTYNNQWMIVDYKAFIPN GPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFESVFNASG LQALVAQYGDWFSYTRNPRAKIFQRDQSLVEDVDTMVRLMRYNDFLHDPL SLCEACSPKPNAENAISARSDLNPANGSYPFQALRQRAHGGIDVKVTSVA LAKYMSMLAASGPTWDQLPPFQWSKSPFHNMLHMGQPDLWMFSPVKVPWD
    • Predicted molecular weight

      78 kDa including tags
    • Amino acids

      36 to 585
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 36 to 585 with 6xHis-SUMO tag at the N-terminus. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • 76 kDa protein
    • LAMA-like protein 2
    • Lamina ancestor homolog 2
    • p76
    • Phospholipase B domain-containing protein 2
    • Plbd2
    • PLBL2_HUMAN
    • Putative phospholipase B-like 2 45 kDa form
    see all
  • Function

    Putative phospholipase.
  • Tissue specificity

    Ubiquitously expressed, with highest levels in heart, brain and liver.
  • Sequence similarities

    Belongs to the phospholipase B-like family.
  • Post-translational
    modifications

    The p76 protein is synthesized as a 80 kDa precursor which is then processed into a N-terminal 32 kDa form and a C-terminal 45 kDa form.
    Glycosylated; contains mannose 6-phosphate sugars.
  • Cellular localization

    Lysosome lumen.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226421 with 5% enrichment gel and 15% separation gel.

References

ab226421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up