Description

  • Product name

    Recombinant Rat Procalcitonin protein
    See all Procalcitonin proteins and peptides
  • Purity

    > 95 % Densitometry.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      MKHHHHHHASVPLRSTLESSPGMATLSEEEARLLAALVQNYMQMKVRELE QEEEQEAEGSSLDSPRSKRCGNLSTCMLGTYTQDLNKFHTFPQTSIGVGA PGKKRDMAKDLETNHHPYFG N
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      26 to 136
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the full length protein from aa 26 to 136, including the propeptide regions. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab207152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.29% Sodium chloride, 0.24% Tris

    Lyophilised from a 0.4 µm filtered solution.

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilised pellet dissolve completely.

General Info

  • Alternative names

    • CALC1
    • CALCA
    • calcitonin related polypeptide alpha
    • CGRP
    • CGRP1
    • CT
    • katacalcin
    • KC
    see all
  • Relevance

    Procalcitonin (PCT) is a 116 amino acid residue peptide with molecular weight of about 13 kDa. PCT itself has no known hormonal activity. PCT belongs to a group of related proteins including calcitonin gene-related peptides I and II, amylin, adrenomodulin and calcitonin (CAPA peptide family). PCT, like other peptides of CAPA family, appears from the common precursor pre-procalcitonin consisting of 141 amino acids by removal of 25 amino acids from the N-terminus. PCT undergoes successive cleavages to form three molecules: N-terminal fragment (55 a.a.), calcitonin (32 a.a.) and katacalcin (21 a.a.). Under normal metabolic conditions, PCT is only present in the C cells of the thyroid gland. In bacterial infection and sepsis, however, intact PCT is found in the blood and, more importantly, its level is related to the severity of bacterial sepsis. Today, PCT is considered to be one of the earliest and most specific markers of sepsis.
  • Cellular localization

    Secreted

Images

  • 14 % SDS-PAGE analysis of ab207152.

    Lane 1: Reduced and boiled sample, 2.5 μg/lane.
    Lane 2: Non-reduced and non-boiled sample, 2.5 μg/lane.

     

    Protein is partially cleaving to propeptide and Calcitonin – lower double band.

References

ab207152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up