Description

  • Product name

    Recombinant Rat Profilin 1 protein
    See all Profilin 1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab207134 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMAGWNAYIDSLMADGTCQDAAIVGYK DSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFFVNGLTLGGQKCSVIRD SLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVHGGLINK KCYEMASHLRRSQY
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      1 to 140
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_071956.

Specifications

Our Abpromise guarantee covers the use of ab207134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 89% PBS, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • Actin binding protein
    • ALS18
    • Epididymis tissue protein Li 184a
    • OTTHUMP00000125244
    • Pfn
    • PFN 1
    • PFN1
    • PROF1_HUMAN
    • Profilin I
    • Profilin-1
    • Profilin1
    • ProfilinI
    see all
  • Function

    Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.
  • Sequence similarities

    Belongs to the profilin family.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab207134.

References

ab207134 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up