Recombinant rat Prolactin Receptor / PRL-R protein (ab170083)

Overview

Description

  • Nature
    Recombinant
  • Source
    Insect cells
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      SPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYEC PDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIV EPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPE EAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVE MPNDFTLKD
    • Molecular weight
      51 kDa
    • Amino acids
      21 to 229

Specifications

Our Abpromise guarantee covers the use of ab170083 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    ED50 <50 ng/ml in the presence of 0.5 ng/ml of recombinant Human prolactin as determined in a cell proliferation assay using Nb2-11 rat lymphoma cells.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .
    ab170083 was purified by chromatography, sterile filtered and lyophilized.
  • Form
    Lyophilised
  • Additional notes

    Previously labelled as Prolactin Receptor. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Constituent: 100% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Add 0.5ml deionized water. Aliquot and freeze unused portion.

General Info

  • Alternative names
    • AI987712
    • CLONE SPM213
    • CPRLP
    • Delta 4-delta 7/11 truncated prolactin receptor
    • Delta 4-SF1b truncated prolactin receptor
    • HPRL
    • hPRL receptor
    • hPRLrI
    • Lactogen receptor
    • MFAB
    • MGC105486
    • OPR
    • OTTHUMP00000115998
    • Pr-1
    • Pr-3
    • PRL R
    • PRL-R
    • PRLR
    • Prlr-rs1
    • PRLR_HUMAN
    • Prolactin receptor
    • Prolactin receptor a
    • Prolactin receptor delta 7/11
    • RATPRLR
    • Secreted prolactin binding protein
    • Truncated testis-specific box 1-C prolactin receptor
    • wu:fj65c07
    see all
  • Function
    This is a receptor for the anterior pituitary hormone prolactin (PRL). Isoform 4 is unable to transduce prolactin signaling. Isoform 6 is unable to transduce prolactin signaling.
  • Tissue specificity
    Expressed in breast, placenta, kidney, liver and pancreas.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 1 subfamily.
    Contains 2 fibronectin type-III domains.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Secreted and Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab170083.

    Lane 1: 3 µg reduced
    Lane 2: 3 µg Non-reduced
    Lane 3: Molecular weight markers

  • Inhibition of prolactin-induced proliferation of Nb2-11 rat lymphoma cells by ab170083.

References

ab170083 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170083.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up