Description

  • Product name

    Recombinant rat Prolactin/PRL protein
    See all Prolactin/PRL proteins and peptides
  • Biological activity

    Activity is measured by inhibitory activity toward prolactin-induced proliferation of Nb2-11 rat lymphoma cells.

  • Purity

    > 95 % SDS-PAGE.
    ab188061 was purified by chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      LPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIA KAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGL GGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQ LPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC
    • Predicted molecular weight

      23 kDa
    • Amino acids

      30 to 226

Specifications

Our Abpromise guarantee covers the use of ab188061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituents: 0.16% Sodium phosphate, 0.29% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Add deionized water to original volume, aliquot and freeze unused portion. (0.05 ml before lyophilisation).

General Info

  • Alternative names

    • Decidual prolactin
    • GHA1
    • Growth hormone A1
    • Lactogenic hormone
    • Luteotropic hormone
    • Mammotropin
    • PRL
    • Prolactin
    • Prolactin precursor
    see all
  • Relevance

    Various hormones are secreted from the anterior pituitary during development and growth. Prolactin is a growth factor secreted by the anterior pituitary that is necessary for the proliferation and differentiation of the mammary glands.
  • Cellular localization

    Secreted

References

ab188061 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up