Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      MLPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFI AKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITG LGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWS QLPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC
    • Molecular weight

      23 kDa
    • Amino acids

      30 to 226
    • Additional sequence information

      This is the full length protein without the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab205520 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The activity is determined by the ability to stimulate proliferation of NB2-11 cells and is typically less than 1 ng/mL. This corresponds to an expected specific activity of 1 x 106 units/mg.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    > 0.050 Eu/µg
  • Purity

    > 97 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 0.16% Sodium phosphate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Sterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution.

General Info

  • Alternative names

    • Decidual prolactin
    • GHA1
    • Growth hormone A1
    • Lactogenic hormone
    • Luteotropic hormone
    • Mammotropin
    • PRL
    • Prolactin
    • Prolactin precursor
    see all
  • Relevance

    Various hormones are secreted from the anterior pituitary during development and growth. Prolactin is a growth factor secreted by the anterior pituitary that is necessary for the proliferation and differentiation of the mammary glands.
  • Cellular localization

    Secreted

References

ab205520 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205520.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up