For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-rat-rantes-protein-ab9784.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Chemokines Beta Chemokines (CC)
Share by email

Recombinant rat RANTES protein (ab9784)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Expression system: Escherichia coli
  • Endotoxin level: < 0.100 Eu/µg
  • Active: Yes

You may also be interested in

ELISA
Product image
Rat Rantes ELISA Kit (ab213907)

View more associated products

Description

  • Product name

    Recombinant rat RANTES protein
    See all RANTES proteins and peptides
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

    P50231
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVC ANPEKKWVQEYINYLEMS
    • Predicted molecular weight

      10 kDa
    • Amino acids

      25 to 92

Associated products

    Specifications

    Our Abpromise guarantee covers the use of ab9784 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Form

      Lyophilized
    • Additional notes

      The biological activity of this product is determined by its ability to chemoattract rat peritoneal macrophages using a concentration of 50.0-100.0 ng/ml.
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      For lot specific reconstitution information please contact our Scientific Support Team.

    General Info

    • Alternative names

      • Beta chemokine RANTES
      • Beta chemokine RANTES precursor
      • C C motif chemokine 5
      • CCL 5
      • CCL5
      • CCL5_HUMAN
      • Chemokine (C C motif) ligand 5
      • Chemokine CC Motif Ligand 5
      • D17S136E
      • EoCP
      • Eosinophil chemotactic cytokine
      • MGC17164
      • RANTES(4-68)
      • Regulated upon activation normally T expressed and presumably secreted
      • SCYA 5
      • SCYA5
      • SIS delta
      • SIS-delta
      • SISd
      • Small inducible cytokine A5
      • Small inducible cytokine A5 (RANTES)
      • Small inducible cytokine subfamily A (Cys Cys) member 5
      • Small-inducible cytokine A5
      • T cell specific protein p288
      • T cell specific protein RANTES
      • T cell specific RANTES protein
      • T cell-specific protein P228
      • T-cell-specific protein RANTES
      • TCP 228
      • TCP228
      see all
    • Function

      Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils.
    • Tissue specificity

      T-cell and macrophage specific.
    • Sequence similarities

      Belongs to the intercrine beta (chemokine CC) family.
    • Post-translational
      modifications

      N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells.
      The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in PubMed:1380064. They are assigned by similarity.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P13501 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab9784? Please let us know so that we can cite the reference in this datasheet.

    ab9784 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab9784.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.