Recombinant rat RANTES protein (ab9784)

Submit a review Submit a question

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 98% SDS-PAGE
  • Active: Yes

Description

  • Product name

    Recombinant rat RANTES protein
    See all RANTES proteins and peptides

  • Purity

    > 98 % SDS-PAGE.
    Sterile filtered Greater than 98% pure by HPLC analyses. Endotoxin level is less than 0.1 ng per g (1EU/g).

  • Expression system

    Escherichia coli

  • Accession

    P50231

  • Protein length

    Full length protein

  • Animal free

    No

  • Nature

    Recombinant

    • Species

      Rat

    • Sequence

      SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVC ANPEKKWVQEYINYLEMS

    • Predicted molecular weight

      10 kDa

    • Amino acids

      25 to 92

Specifications

Our Abpromise guarantee covers the use of ab9784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Form

    Lyophilized

  • Additional notes

    The biological activity of this product is determined by its ability to chemoattract rat peritoneal macrophages using a concentration of 50.0-100.0 ng/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • Beta chemokine RANTES
    • Beta chemokine RANTES precursor
    • C C motif chemokine 5
    • CCL 5
    • CCL5
    • CCL5_HUMAN
    • Chemokine (C C motif) ligand 5
    • Chemokine CC Motif Ligand 5
    • D17S136E
    • EoCP
    • Eosinophil chemotactic cytokine
    • MGC17164
    • RANTES(4-68)
    • Regulated upon activation normally T expressed and presumably secreted
    • SCYA 5
    • SCYA5
    • SIS delta
    • SIS-delta
    • SISd
    • Small inducible cytokine A5
    • Small inducible cytokine A5 (RANTES)
    • Small inducible cytokine subfamily A (Cys Cys) member 5
    • Small-inducible cytokine A5
    • T cell specific protein p288
    • T cell specific protein RANTES
    • T cell specific RANTES protein
    • T cell-specific protein P228
    • T-cell-specific protein RANTES
    • TCP 228
    • TCP228
    see all

  • Function

    Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils.

  • Tissue specificity

    T-cell and macrophage specific.

  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.

  • Post-translational
    modifications

    N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells.
    The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in PubMed:1380064. They are assigned by similarity.

  • Cellular localization

    Secreted.
  • Information by UniProt

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

References (0)

Publishing research using ab9784? Please let us know so that we can cite the reference in this datasheet.

ab9784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab9784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com