Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      SSFTNVTSPVVLTNYLDTQYYGEIGIGTPSQTFKVIFDTGSANLWVPSTK CGPLYTACEIHNLYDSSESSSYMENGTEFTIHYGSGKVKGFLSQDVVTVG GIIVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVDGVIPVFDHILSQ RVLKEEVFSVYYSRESHLLGGEVVLGGSDPQHYQGNFHYVSISKAGSWQI TMKGVSVGPATLLCEEGCMAVVDTGTSYISGPTSSLQLIMQALGVKEKRA NNYVVNCSQVPTLPDISFYLGGRTYTLSNMDYVQKNPFRNDDLCILALQG LDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALARHHHHHHHHH
    • Molecular weight

      39 kDa including tags
    • Amino acids

      65 to 402
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein without the signal peptide and propeptide

Specifications

Our Abpromise guarantee covers the use of ab198117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    >= 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Angiotensin forming enzyme
    • Angiotensin forming enzyme precursor
    • Angiotensinogenase
    • Angiotensinogenase precursor
    • FLJ10761
    • HNFJ2
    • REN
    • Ren1
    • RENI_HUMAN
    • Renin
    • Renin precursor renal
    see all
  • Function

    Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
  • Involvement in disease

    Defects in REN are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype).
    Defects in REN are the cause of familial juvenile hyperuricemic nephropathy type 2 (HNFJ2) [MIM:613092]. It is a renal disease characterized by juvenile onset of hyperuricemia, slowly progressive renal failure and anemia.
  • Sequence similarities

    Belongs to the peptidase A1 family.
  • Cellular localization

    Secreted. Membrane. Associated to membranes via binding to ATP6AP2.
  • Information by UniProt

Images

  • Specific activity of ab198117

  • 10% SDS-PAGE stained with Coomassie Blue.
    Lane 1: ab198117 (2 µg)
    Lane 2: Protein Marker

References

ab198117 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up