Description

  • Product name

    Recombinant Rat SOD2/MnSOD protein (His tag)
    See all SOD2/MnSOD proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab222787 was affinity purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      KHSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVNNLNVTEEKYHEALA KGDVTTQVALQPALKFNGGGHINHSIFWTNLSPKGGGEPKGELLEAIKRD FGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTT GLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSQRYIVCKK
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      25 to 222
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 25 to 222. The transit peptide is not included (BC070913).

Specifications

Our Abpromise guarantee covers the use of ab222787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.70
    Constituents: 1.74% Sodium chloride, 0.79% Tris HCl

General Info

  • Alternative names

    • Indophenoloxidase B
    • IPO B
    • IPOB
    • Manganese containing superoxide dismutase
    • Manganese SOD
    • Manganese superoxide dismutase
    • Mangano superoxide dismutase
    • Mn SOD
    • Mn superoxide dismutase
    • MNSOD
    • MVCD6
    • SOD 2
    • SOD2
    • SODM_HUMAN
    • Superoxide dismutase [Mn] mitochondrial
    • Superoxide dismutase [Mn], mitochondrial
    • Superoxide dismutase 2 mitochondrial
    see all
  • Function

    Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
  • Involvement in disease

    Genetic variation in SOD2 is associated with susceptibility to microvascular complications of diabetes type 6 (MVCD6) [MIM:612634]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
  • Sequence similarities

    Belongs to the iron/manganese superoxide dismutase family.
  • Post-translational
    modifications

    Nitrated under oxidative stress. Nitration coupled with oxidation inhibits the catalytic activity.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab222787.

References

ab222787 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222787.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up