For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-rat-tissue-plasminogen-activator-protein-ab92596.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Blood Serum Proteins
Share by email

Recombinant rat Tissue Plasminogen Activator protein (ab92596)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant rat Tissue Plasminogen Activator protein (ab92596)

    Key features and details

    • Expression system: Insect cells
    • Purity: > 95% SDS-PAGE
    • Active: Yes
    • Suitable for: SDS-PAGE, Functional Studies

    Description

    • Product name

      Recombinant rat Tissue Plasminogen Activator protein
      See all Tissue Plasminogen Activator proteins and peptides
    • Purity

      > 95 % SDS-PAGE.

    • Expression system

      Insect cells
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Rat
      • Sequence

        MKGELLCVLLLCGVAFTLPDQGIHRRFRRGARSYRATCRDEQTQTTYQQH QSWLRPMLRGNRVEYCRCNSGLAQCHSVPVRSCSEPRCFNGGTCQQALYF SDFVCQCPDGFVGKRCDIDTRATCFEGQGITYRGTWSTAENGAECINWNS SALSQKPYSARRPNAIKLGLGNHNYCRNPDRDVKPWCYVFKAGKYTTEFC
      • Amino acids

        1 to 559

    Associated products

    • Related Products

      • Anti-Tissue Plasminogen Activator antibody [H27B6] (ab28374)
      • Anti-Tissue Plasminogen Activator antibody (ab62763)

    Specifications

    Our Abpromise guarantee covers the use of ab92596 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      Functional Studies

    • Form

      Liquid
    • Additional notes


      ab92596 is >85% single chain and >95% active. It is fully complexable with Human PAI-1.

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 7.40
      Constituents: 9.52% HEPES, 0.58% Sodium chloride

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    General Info

    • Alternative names

      • Alteplase
      • DKFZp686I03148
      • Plasminogen activator tissue
      • Plasminogen activator tissue type
      • PLAT
      • Reteplase
      • t PA
      • T Plasminogen Activator
      • t-PA
      • T-plasminogen activator
      • Tissue plasminogen activator (t PA)
      • Tissue type plasminogen activator
      • Tissue-type plasminogen activator chain B
      • tPA
      • TPA_HUMAN
      • TPA1
      see all
    • Function

      Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue remodeling and degradation, in cell migration and many other physiopathological events. Play a direct role in facilitating neuronal migration.
    • Tissue specificity

      Synthesized in numerous tissues (including tumors) and secreted into most extracellular body fluids, such as plasma, uterine fluid, saliva, gingival crevicular fluid, tears, seminal fluid, and milk.
    • Involvement in disease

      Note=Increased activity of TPA results in increased fibrinolysis of fibrin blood clots that is associated with excessive bleeding. Defective release of TPA results in hypofibrinolysis that can lead to thrombosis or embolism.
    • Sequence similarities

      Belongs to the peptidase S1 family.
      Contains 1 EGF-like domain.
      Contains 1 fibronectin type-I domain.
      Contains 2 kringle domains.
      Contains 1 peptidase S1 domain.
    • Domain

      Both FN1 and one of the kringle domains are required for binding to fibrin.
      Both FN1 and EGF-like domains are important for binding to LRP1.
      The FN1 domain mediates binding to annexin A2.
      The second kringle domain is implicated in binding to cytokeratin-8 and to the endothelial cell surface binding site.
    • Post-translational
      modifications

      The single chain, almost fully active enzyme, can be further processed into a two-chain fully active form by a cleavage after Arg-310 catalyzed by plasmin, tissue kallikrein or factor Xa.
      Differential cell-specific N-linked glycosylation gives rise to two glycoforms, type I (glycosylated at Asn-219) and type II (not glycosylated at Asn-219). The single chain type I glycoform is less readily converted into the two-chain form by plasmin, and the two-chain type I glycoform has a lower activity than the two-chain type II glycoform in the presence of fibrin.
      N-glycosylation of Asn-152; the bound oligomannosidic glycan is involved in the interaction with the mannose receptor.
      Characterization of O-linked glycan was studied in Bowes melanoma cell line.
    • Cellular localization

      Secreted > extracellular space.
    • Target information above from: UniProt accession P00750 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant rat Tissue Plasminogen Activator protein (ab92596)
      SDS-PAGE - Recombinant rat Tissue Plasminogen Activator protein (ab92596)
      10% SDS-PAGE
      Lane 1: TPA Tissue Plasminogen Activator (3ug) Non-reduced
      Lane 2: TPA Tissue Plasminogen Activator (3ug) + PAI-1 (12ug) Non-reduced
      Lane 3: Prestained Standard

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab92596? Please let us know so that we can cite the reference in this datasheet.

    ab92596 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab92596.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.