Bioactive grade

Recombinant rhesus monkey CD134 / OX40L receptor protein (Fc Chimera Active) (ab221407)

Description

  • Product name

    Recombinant rhesus monkey CD134 / OX40L receptor protein (Fc Chimera Active)
    See all CD134 / OX40L receptor proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Human OX40 Ligand, His Tag at 5 μg/ml (100 μl/well) can bind ab221407 with a linear range of 1-20 ng/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rhesus monkey
    • Sequence

      KLHCVGDTYPSNDRCCQECRPGNGMVSRCNRSQNTVCRPCGPGFYNDVVS AKPCKACTWCNLRSGSERKQPCTATQDTVCRCRAGTQPLDSYKPGVDCAP CPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPPTQPQ ETQGPPARPTTVQPTEAWPRTSQRPSTRPVEVPRGPA
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      28 to 214
    • Additional sequence information

      Fused with a human IgG1 Fc tag (Pro 100 - Lys 330; P01857) at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab221407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • ACT 35
    • ACT35
    • ACT35 antigen
    • ATC35 antigen
    • CD 134
    • CD134
    • CD134 antigen
    • IMD16
    • Lymphoid activation antigene ACT35
    • OX 40
    • OX40
    • OX40 antigen
    • OX40 cell surface antigen
    • OX40 homologue
    • OX40L receptor
    • TAX transcriptionally activated glycoprotein 1 receptor
    • TAX transcriptionally-activated glycoprotein 1 receptor
    • TNF receptor superfamily member 4
    • TNFRSF 4
    • TNFRSF4
    • TNR4_HUMAN
    • Tumor necrosis factor receptor superfamily member 4
    • Txgp 1l
    • Txgp1
    • Txgp1l
    see all
  • Function

    Receptor for TNFSF4/OX40L/GP34.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab221407 stained overnight with Coomassie Blue.

    The reduced protein migrates as 66-70 kDa in SDS-PAGE.

  • Immobilized Human OX40 Ligand, His Tag at 5 μg/ml (100 μl/well) can bind ab221407 with a linear range of 1-20 ng/ml.

References

ab221407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up