Recombinant Rhesus monkey CD4 protein (Fc Chimera) (ab201425)

Description

  • Product name

    Recombinant Rhesus monkey CD4 protein (Fc Chimera)
    See all CD4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rhesus monkey
    • Sequence

      KKVVLGKKGDTVELTCNASQKKNTQFHWKNSNQIKILGIQGSFLTKGPSK LSDRADSRKSLWDQGCFSMIIKNLKIEDSDTYICEVENKKEEVELLVFGL TANSDTHLLEGQSLTLTLESPPGSSPSVKCRSPGGKNIQGGRTLSVPQLE RQDSGTWTCTVSQDQKTVEFKIDIVVLAFQKASSTVYKKEGEQVEFSFPP AFTLEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMG KKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQFQEN LTCEVWGPTSPKLTLSLKLENKGTTVSKQAKAVWVLNPEAGMWQCLLSDS GQVLLESNIKVVPTW
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      26 to 390
    • Additional sequence information

      Fused with a Human IgG1 Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab201425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 0.06% Sodium chloride, L-Arginine

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is about 3-5%. Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD 4
    • CD4
    • CD4 (L3T4)
    • CD4 antigen
    • CD4 antigen (p55)
    • CD4 molecule
    • CD4 receptor
    • CD4+ Lymphocyte deficiency, included
    • CD4_HUMAN
    • CD4mut
    • L3T4
    • Leu3
    • Ly-4
    • Lymphocyte antigen CD4
    • MGC165891
    • OTTHUMP00000238897
    • p55
    • T cell antigen T4
    • T cell antigen T4/LEU3
    • T cell differentiation antigen L3T4
    • T cell OKT4 deficiency, included
    • T cell surface antigen T4/Leu 3
    • T cell surface antigen T4/Leu3
    • T cell surface glycoprotein CD4
    • T-cell surface antigen T4/Leu-3
    • T-cell surface glycoprotein CD4
    • W3/25
    • W3/25 antigen
    see all
  • Function

    Accessory protein for MHC class-II antigen/T-cell receptor interaction. May regulate T-cell activation. Induces the aggregation of lipid rafts.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Palmitoylation and association with LCK contribute to the enrichment of CD4 in lipid rafts.
  • Cellular localization

    Cell membrane. Localizes to lipid rafts. Removed from plasma membrane by HIV-1 Nef protein that increases clathrin-dependent endocytosis of this antigen to target it to lysosomal degradation. Cell surface expression is also down-modulated by HIV-1 Envelope polyprotein gp160 that interacts with, and sequesters CD4 in the endoplasmic reticulum.
  • Information by UniProt

Images

  • The purity of ab201425 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 70-80 kDa in SDS-PAGE due to glycosylation.

References

ab201425 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201425.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up