Recombinant rhesus monkey CD40 protein (Fc Chimera) (ab208480)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant rhesus monkey CD40 protein (Fc Chimera)
See all CD40 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized ab208480 at 2μg/mL (100 µl/well), can bind Recombinant Human CD40LG /CD40 Ligand Protein with a linear of 5-50 ng/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Rhesus monkey -
Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCSESEFLDT WNRETRCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGLHCMSESCESCV PHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETK DLVVQQAGTNKTDVVCGPQDRQR -
Predicted molecular weight
46 kDa including tags -
Amino acids
21 to 193 -
Additional sequence information
Chimera fused with a Human IgG1 Fc tag at the C-terminus (NP_001252791.1).
-
Specifications
Our Abpromise guarantee covers the use of ab208480 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -80°C.
pH: 7.40
Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride
Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 250 µg/ml.
General Info
-
Alternative names
- AI326936
- B cell associated molecule CD40
- B cell surface antigen CD40
see all -
Function
Receptor for TNFSF5/CD40LG. -
Tissue specificity
B-cells and in primary carcinomas. -
Involvement in disease
Defects in CD40 are the cause of hyper-IgM immunodeficiency syndrome type 3 (HIGM3) [MIM:606843]; also known as hyper-IgM syndrome 3. HIGM3 is an autosomal recessive disorder which includes an inability of B cells to undergo isotype switching, one of the final differentiation steps in the humoral immune system, an inability to mount an antibody-specific immune response, and a lack of germinal center formation. -
Sequence similarities
Contains 4 TNFR-Cys repeats. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab208480 has not yet been referenced specifically in any publications.