Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Rhesus monkey
    • Sequence

      KAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGA WCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKIN YSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTD HSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAV GYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEI MFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFP LVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMY NNSGALPTSPMTPTTYDPMLKIDDSNTR
    • Molecular weight

      69 kDa including tags
    • Amino acids

      22 to 399
    • Additional sequence information

      Fused with a human IgG1 Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab219680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD167 antigen-like family member B
    • CD167b
    • CD167b antigen
    • Cell migration inducing protein 20
    • DDR 2
    • DDR2
    • DDR2_HUMAN
    • Discoidin domain containing receptor 2
    • Discoidin domain receptor 2
    • Discoidin domain receptor family member 2
    • discoidin domain receptor tyrosine kinase 2
    • Discoidin domain-containing receptor 2
    • discoidin domain-containing receptor tyrosine kinase 2
    • Hydroxyaryl protein kinase
    • MIG20a
    • Migration inducing gene 16 protein
    • Neurotrophic tyrosine kinase
    • Neurotrophic tyrosine kinase receptor related 3
    • NTRKR 3
    • NTRKR3
    • Receptor protein tyrosine kinase TKT
    • Receptor protein-tyrosine kinase TKT
    • Receptor related 3
    • receptor-related 3
    • TKT
    • TYRO 10
    • TYRO10
    • Tyrosine kinase receptor related to neurotrophic TRK
    • Tyrosine protein kinase TYRO 10
    • Tyrosine protein kinase TYRO10
    • Tyrosine-protein kinase TYRO10
    • Tyrosylprotein kinase
    see all
  • Function

    This tyrosine kinase receptor for fibrillar collagen mediates fibroblast migration and proliferation. Contributes to cutaneous wound healing.
  • Tissue specificity

    The major 10 kDa transcript is expressed in high levels in heart and lung, less in brain, placenta, liver, skeletal muscle, pancreas, and kidney.
  • Involvement in disease

    Defects in DDR2 are the cause of spondyloepimetaphyseal dysplasia short limb-hand type (SEMD-SL) [MIM:271665]. A bone disease characterized by short-limbed dwarfism, a narrow chest with pectus excavatum, brachydactyly in the hands and feet, a characteristic craniofacial appearance and premature calcifications. The radiological findings are distinctive and comprise short long bones throughout the skeleton with striking epiphyses that are stippled, flattened and fragmented and flared, irregular metaphyses. Platyspondyly in the spine with wide intervertebral spaces is observed and some vertebral bodies are pear-shaped with central humps, anterior protrusions and posterior scalloping.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 1 F5/8 type C domain.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab219680 stained overnight with Coomassie Blue.

    The reduced protein migrates as 80-95 kDa in SDS-PAGE due to glycosylation.

References

ab219680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up