Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Rhesus monkey
    • Sequence

      QKECVCENYKLAVNCFLNDNGQCQCTSIGAQNTVLCSKLAAKCLVMKAEM NGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAG VRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDVQSLRTALEEAIKTR YQLDPKFITNILYEDNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGE SLFHSKKMDLRVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
    • Molecular weight

      28 kDa including tags
    • Amino acids

      24 to 265
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab226418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 50 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. Store at -70°C for 3 months under sterile conditions after reconstitution.

General Info

  • Alternative names

    • 17 1A
    • 323/A3
    • Adenocarcinoma associated antigen
    • Adenocarcinoma-associated antigen
    • Antigen identified by monoclonal antibody AUA1
    • AUA1
    • CD326
    • CD326 antigen
    • Cell surface glycoprotein Trop 1
    • Cell surface glycoprotein Trop 2
    • Cell surface glycoprotein Trop-1
    • CO 17A
    • CO17 1A
    • CO17A
    • DIAR5
    • EGP
    • EGP 2
    • EGP2
    • EGP314
    • EGP40
    • Ep CAM
    • Ep-CAM
    • EPCAM
    • EPCAM_HUMAN
    • EpCAM1
    • Epithelial cell adhesion molecule
    • Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD)
    • Epithelial cell surface antigen
    • Epithelial cellular adhesion molecule
    • Epithelial glycoprotein
    • Epithelial glycoprotein 1
    • Epithelial glycoprotein 314
    • ESA
    • GA733 1
    • GA733 2
    • GA733-2
    • gastrointestinal tumor-associated antigen 2, 35-KD glycoprotein
    • gp4
    • hEGP 2
    • hEGP314
    • HNPCC8
    • Human epithelial glycoprotein 2
    • KS 1/4 antigen
    • KS1/4
    • KSA
    • Ly74
    • Lymphocyte antigen 74
    • M1S 1
    • M1S2
    • M4S1
    • Major gastrointestinal tumor associated protein GA733 2
    • Major gastrointestinal tumor-associated protein GA733-2
    • mEGP314
    • Membrane component chromosome 4 surface marker (35kD glycoprotein)
    • Membrane component, chromosome 4, surface marker
    • Membrane component, chromosome 4, surface marker 1
    • MIC18
    • MK 1
    • Protein 289A
    • TACD1
    • TACSTD1
    • TROP1
    • Tumor associated calcium signal transducer 1
    • Tumor associated calcium signal transducer 2 precursor
    • Tumor-associated calcium signal transducer 1
    see all
  • Function

    May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
  • Tissue specificity

    Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.
  • Involvement in disease

    Defects in EPCAM are the cause of diarrhea type 5 (DIAR5) [MIM:613217]. It is an intractable diarrhea of infancy characterized by villous atrophy and absence of inflammation, with intestinal epithelial cell dysplasia manifesting as focal epithelial tufts in the duodenum and jejunum.
    Defects in EPCAM are a cause of hereditary non-polyposis colorectal cancer type 8 (HNPCC8) [MIM:613244]. HNPCC is a disease associated with marked increase in cancer susceptibility. It is characterized by a familial predisposition to early-onset colorectal carcinoma (CRC) and extra-colonic tumors of the gastrointestinal, urological and female reproductive tracts. HNPCC is reported to be the most common form of inherited colorectal cancer in the Western world. Clinically, HNPCC is often divided into two subgroups. Type I is characterized by hereditary predisposition to colorectal cancer, a young age of onset, and carcinoma observed in the proximal colon. Type II is characterized by increased risk for cancers in certain tissues such as the uterus, ovary, breast, stomach, small intestine, skin, and larynx in addition to the colon. Diagnosis of classical HNPCC is based on the Amsterdam criteria: 3 or more relatives affected by colorectal cancer, one a first degree relative of the other two; 2 or more generation affected; 1 or more colorectal cancers presenting before 50 years of age; exclusion of hereditary polyposis syndromes. The term 'suspected HNPCC' or 'incomplete HNPCC' can be used to describe families who do not or only partially fulfill the Amsterdam criteria, but in whom a genetic basis for colon cancer is strongly suspected. Note=HNPCC8 results from heterozygous deletion of 3-prime exons of EPCAM and intergenic regions directly upstream of MSH2, resulting in transcriptional read-through and epigenetic silencing of MSH2 in tissues expressing EPCAM.
  • Sequence similarities

    Belongs to the EPCAM family.
    Contains 1 thyroglobulin type-1 domain.
  • Post-translational
    modifications

    Hyperglycosylated in carcinoma tissue as compared with autologous normal epithelia. Glycosylation at Asn-198 is crucial for protein stability.
  • Cellular localization

    Lateral cell membrane. Cell junction > tight junction. Co-localizes with CLDN7 at the lateral cell membrane and tight junction.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab226418 under reducing conditions.

    Migrates at 28-40 kDa due to differential glycosylation.

References

ab226418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up