Bioactive grade

Recombinant rhesus monkey Flt3 ligand/Flt3L protein (ab200249)

Description

  • Product name

    Recombinant rhesus monkey Flt3 ligand/Flt3L protein
    See all Flt3 ligand/Flt3L proteins and peptides
  • Biological activity

    The ED50 as calculated by the dose-dependent stimulation of the proliferation of Human AML5 cells is less than 1.0 ng/ml, corresponding to a Specific Activity of 1.0×106 IU/mg.

  • Purity

    > 97 % SDS-PAGE.
    Purity: >97% by SDS-PAGE and HPLC analyses.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rhesus monkey
    • Sequence

      TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVPSNLQDEELCGALWRL VLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQHPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPRSPGALEA TALTAPQRP
    • Predicted molecular weight

      18 kDa
    • Amino acids

      27 to 185

Specifications

Our Abpromise guarantee covers the use of ab200249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Flt3 ligand.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • FL
    • Flt 3 ligand
    • Flt 3L
    • Flt3 L
    • FLT3 LG
    • Flt3 ligand
    • Flt3L
    • FLT3L_HUMAN
    • Flt3lg
    • Fms related tyrosine kinase 3 ligand
    • Fms-related tyrosine kinase 3 ligand
    • SL cytokine
    see all
  • Function

    Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab200249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up