Recombinant rhesus monkey GM-CSF protein (Active) (ab243115)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
Description
-
Product name
Recombinant rhesus monkey GM-CSF protein (Active)
See all GM-CSF proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of >1.0x107 IU/mg.
-
Purity
> 98 % SDS-PAGE.
> 98 % by HPLC. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rhesus monkey -
Sequence
APARSPSPGTQPWEHVNAIQEARRLLNLSRDTAAEMNKTVEVVSEMFDLQ EPSCLQTRLELYKQGLQGSLTKLKGPLTMMASHYKQHCPPTPETSCATQI ITFQSFKENLKDFLLVIPFDCWEPVQE -
Predicted molecular weight
16 kDa -
Amino acids
18 to 144 -
Additional sequence information
This product is the mature full length protein from aa 18 to 144. The signal peptide is not included.
-
Specifications
Our Abpromise guarantee covers the use of ab243115 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: PBS
0.2 µm filtered.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- Colony stimulating factor
- Colony Stimulating Factor 2
- Colony stimulating factor 2 (granulocyte-macrophage)
see all -
Function
Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. -
Sequence similarities
Belongs to the GM-CSF family. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243115 has not yet been referenced specifically in any publications.