Description

  • Product name

    Recombinant Rhesus monkey IL-10 protein (His tag)
    See all IL-10 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rhesus monkey
    • Sequence

      SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKE SLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKT LRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYI EAYMTMKIQN
    • Predicted molecular weight

      21 kDa including tags
    • Amino acids

      19 to 178
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 19 to 178. The signal peptide and propeptide are not included. 10xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 50% Glycerol, 0.16% Tris HCl, 0.03% EDTA

General Info

  • Alternative names

    • CSIF
    • Cytokine synthesis inhibitory factor
    • GVHDS
    • IL 10
    • IL-10
    • IL10
    • IL10_HUMAN
    • IL10A
    • Interleukin 10
    • Interleukin-10
    • MGC126450
    • MGC126451
    • T-cell growth inhibitory factor
    • TGIF
    see all
  • Function

    Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
  • Tissue specificity

    Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.
  • Sequence similarities

    Belongs to the IL-10 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab239538.

References

ab239538 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up