Description

  • Product name

    Recombinant Rhesus monkey IL-17A protein (Tagged)
    See all IL-17A proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rhesus monkey
    • Sequence

      GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSP WNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLR REPRHCPNSFRLEKILVSVGCTCVTPIVHHVA
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      24 to 155
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 24 to 155. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab235565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • CTLA 8
    • CTLA-8
    • CTLA8
    • cytotoxic T lymphocyte associated antigen 8
    • Cytotoxic T lymphocyte associated protein 8
    • Cytotoxic T lymphocyte associated serine esterase 8
    • Cytotoxic T-lymphocyte-associated antigen 8
    • IL 17
    • IL 17A
    • IL-17
    • IL-17A
    • IL17
    • IL17_HUMAN
    • Il17a
    • Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8)
    • interleukin 17A
    • Interleukin-17A
    • interleukin17
    • Interleukin17A
    • OTTHUMP00000016597
    • OTTMUSP00000046003
    see all
  • Function

    Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts.
  • Tissue specificity

    Restricted to activated memory T-cells.
  • Sequence similarities

    Belongs to the IL-17 family.
  • Post-translational
    modifications

    Found both in glycosylated and nonglycosylated forms.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235565.

References

ab235565 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235565.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up