Description

  • Product name

    Recombinant rhesus monkey IP10 protein (Active)
    See all IP10 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10- 50 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    >97% as determined by HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rhesus monkey
    • Sequence

      IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGE KRCLNPESKAIKNLLKAVSKERSKRSP
    • Predicted molecular weight

      9 kDa
    • Amino acids

      22 to 98
    • Additional sequence information

      Full-length mature chain lacking the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab243264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Interferon gamma induced factor MOB1, mouse, homolog of
    • Interferon gamma induced protein 10
    • 10 kDa interferon gamma induced protein
    • 10 kDa interferon gamma-induced protein
    • C X C motif chemokine 10
    • C7
    • Chemokine (C X C motif) ligand 10
    • Chemokine CXC motif ligand 10
    • Crg 2
    • CRG2
    • CXCL10
    • CXCL10(1-73)
    • CXL10_HUMAN
    • Gamma IP10
    • Gamma-IP10
    • gIP 10
    • GIP10
    • IFI10
    • INP 10
    • INP10
    • Interferon activated gene 10
    • Interferon gamma induced cell line
    • Interferon inducible cytokine IP 10
    • Interferon inducible cytokine IP10
    • IP 10
    • IP-10
    • Mob 1
    • MOB1
    • Protein 10 from interferon (gamma) induced cell line
    • SCYB10
    • Small inducible cytokine B10
    • Small inducible cytokine B10 precursor
    • Small inducible cytokine subfamily B (Cys X Cys) member 10
    • Small inducible cytokine subfamily B CXC member 10
    • Small inducible cytokine subfamily B, member 10
    • Small-inducible cytokine B10
    see all
  • Function

    Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    CXCL10(1-73) is produced by proteolytic cleavage after secretion from keratinocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab243264

References

ab243264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up