Description

  • Product name

    Recombinant Rhesus monkey SAA1 protein
    See all SAA1 proteins and peptides
  • Biological activity

    Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/ml
  • Purity

    > 97 % SDS-PAGE.
    ab110685 is purified by proprietary chromatographic techniques. Purity by HPLC is 97%.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rhesus monkey
    • Sequence

      RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPG GVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGL PEKY
    • Predicted molecular weight

      12 kDa
    • Amino acids

      1 to 104

Specifications

Our Abpromise guarantee covers the use of ab110685 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    pH: 7.40
    Constituent: PBS

  • Reconstitution
    Reconstitute in sterile ddH2O to a concentration of 100 µg/ml. This solution can then be diluted into other aqueous buffers.

General Info

  • Alternative names

    • amyloid A, serum
    • Amyloid fibril protein AA
    • Amyloid protein A
    • MGC111216
    • PIG4
    • SAA
    • SAA2
    • Serum amyloid A protein
    • serum amyloid A-1 protein
    • serum amyloid A1
    • TP53I4
    • Tumor protein p53 inducible protein 4
    see all
  • Relevance

    Major acute phase reactant. Apolipoprotein of the HDL complex.
  • Cellular localization

    Secreted

References

ab110685 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab110685.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up