Bioactive grade

Recombinant rhesus monkey Serum Amyloid A protein (Active) (ab243256)

Description

  • Product name

    Recombinant rhesus monkey Serum Amyloid A protein (Active)
    See all Serum Amyloid A proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rhesus monkey
    • Sequence

      RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPG GVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGL PEKY
    • Predicted molecular weight

      12 kDa
    • Amino acids

      19 to 122
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab243256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Amyloid fibrils
    • SAA 2
    • Serum amyloid A1 isoform 2
    • TP53I4
    • Amyloid fibril protein AA
    • Amyloid protein A
    • Fibrils
    • MGC111216
    • OC
    • OTTMUSP0000004557
    • PIG 4
    • PIG4
    • SAA
    • SAA 1
    • SAA_HUMAN
    • SAA1
    • SAA2
    • serum amyloid A
    • Serum amyloid A 1
    • Serum amyloid A protein precursor
    • Serum amyloid A1 isoform 1
    • Serum amyloid protein A(4-101)
    • Tumor protein p53 inducible protein 4
    see all
  • Relevance

    Function: Major acute phase reactant. Apolipoprotein of the HDL complex. Tissue specificity: Expressed by the liver; secreted in plasma. Disease: Note=Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. Note=Elevated serum SAA protein levels may be associated with lung cancer. Similarity: Belongs to the SAA family. PTM: This protein is the precursor of amyloid protein A, which is formed by the removal of approximately 24 residues from the C-terminal end.

Images

  • SDS Page analysis of ab243256

References

ab243256 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up