Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Rhesus monkey
    • Sequence

      DSEEDEEYTIITDTELPPLKLMHSFCAFKPDDGPCKAIMKRFFFNIFTRQ CEEFIYGGCGGNQNRFESMEECKKVCTRDNVHRIIQTALQQEKPDFCFLE EDPGICRGYITRYFYNNQSKQCERFKYGGCLGNMNNFETLEECKNTCEDG LNGFQVDNYGTQLNAVNNSQTPQSTKVPSFFEFHGPSWCLAPADRGLCRA NENRFYYNSVIGKCRPFKYSGCGGNENNFTSKRECLRACKKGFIQRISKG GLIK
    • Molecular weight

      31 kDa including tags
    • Amino acids

      29 to 282
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab207105 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Anti convertin
    • EPI
    • Extrinsic pathway inhibitor
    • LACI
    • Lipoprotein associated coagulation inhibitor
    • Lipoprotein-associated coagulation inhibitor
    • TFI
    • TFPI
    • TFPI 1
    • TFPI1
    • TFPI1_HUMAN
    • Tissue factor pathway inhibitor
    • Tissue factor pathway inhibitor (lipoprotein associated coagulation inhibitor)
    see all
  • Function

    Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
  • Tissue specificity

    Mostly in endothelial cells.
  • Sequence similarities

    Contains 3 BPTI/Kunitz inhibitor domains.
  • Domain

    This inhibitor contains three inhibitory domains. The first domain interacts with VIIa and TF, the second one with Xa.
  • Post-translational
    modifications

    O-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • DTT-reduced SDS-PAGE analysis of ab207105 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 41-45 kDa in SDS-PAGE due to glycosylation.

References

ab207105 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207105.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up