Recombinant Ribosome inactivating protein alpha trichosanthin (Tagged) (ab236919)

Description

  • Product name

    Recombinant Ribosome inactivating protein alpha trichosanthin (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALI HLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAM RKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASA LMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQ IASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      24 to 270
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber). N-terminal 6xHis-SUMO-tag. Full length mature chain without signal peptide and without propeptide.

Specifications

Our Abpromise guarantee covers the use of ab236919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel analysis of ab236919.

References

ab236919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up