Recombinant RNA directed RNA polymerase L protein (His tag) (ab239435)
Key features and details
- Expression system: Escherichia coli
- Purity: > 85% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant RNA directed RNA polymerase L protein (His tag) -
Purity
> 85 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Sequence
ICIANHIDYEKWNNHQRKLSNGPVFRVMGQFLGYPSLIERTHEFFEKSLI YYNGRPDLMRVHNNTLVNSTSQRVCWQGQEGGLEGLRQKGWSILNLLVIQ REAKIRNTAVKVLAQGDNQVICTQYKTKKSRNVVELQSALNQMVSNNEKI MTAIKIGTGKLGLLINDDETMQSADYLNYGKIPIFRG -
Predicted molecular weight
25 kDa including tags -
Amino acids
598 to 784 -
Tags
His tag N-Terminus -
Additional sequence information
Vesicular stomatitis Indiana virus (strain 94GUB Central America) (VSIV). RdRp catalytic domain.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab239435 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- Large structural protein
- Protein L
- Replicase
- Transcriptase
-
Relevance
RNA-directed RNA polymerase that catalyzes the transcription of viral mRNAs, their capping and polyadenylation. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The viral polymerase binds to the genomic RNA at the 3' leader promoter, and transcribes subsequently all viral mRNAs with a decreasing efficiency. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein acts as a processivity factor. Capping is concommitant with initiation of mRNA transcription. Indeed, a GDP polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both acticities being carried by the viral polymerase. Polyadenylation of mRNAs occur by a stuttering mechanism at a slipery stop site present at the end viral genes. After finishing transcription of a mRNA, the polymerase can resume transcription of the downstream gene.
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab239435 has not yet been referenced specifically in any publications.