For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Explore the power of knock-out cell lines for your research

  1. Link

    recombinant-rubella-virus-capsid-nucleoprotein-protein-his-tag-ab256430.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Microbiology Organism Virus RNA Virus ssRNA positive strand virus Rubella
Share by email

Recombinant Rubella Virus capsid nucleoprotein protein (His tag) (ab256430)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Rubella Virus capsid protein (ab256430)
  • Functional Studies - Recombinant Rubella Virus capsid protein (ab256430)
  • Functional Studies - Recombinant Rubella Virus capsid protein (ab256430)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Tags: His tag C-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

Protein
Product image
Recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Active) (ab273068)
Protein
Recombinant SARS Nucleocapsid Protein (Coronavirus) (ab49042)
Primary
Product image
Anti-CDCA7L/HR1 antibody (ab70637)

View more associated products

Description

  • Product name

    Recombinant Rubella Virus capsid nucleoprotein protein (His tag)
    See all Rubella Virus capsid proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Buffered in 20mM TRIS-HCl pH8.0, 50mM NaCl, 0.5% SDS. Purified from cell lysate.
  • Expression system

    HEK 293 cells
  • Accession

    P07566
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rubella virus
    • Sequence

      MASTTPITMEDLQKALEAQSRALRAELAAGASQSRRPRPPRQRDSSTSGD DSGRDSGGPRRRRGNRGRGQRRDWSRAPPPPEERQETRSQTPAPKPSRAP PQQPQPPRMQTGRGGSAPRPELGPPTNPFQAAVARGLRPPLHDPDTEAPT EACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPE PPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVRGL DGDSAPLPPHTTERIETRSARHPWRIRFGAPQAFLAGLLLATVAVGTARA
    • Amino acids

      1 to 300
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_0628841.1. Strain F-Therien. C-terminal 10 amino acid Gly-Ser linker connecting the protein to a 6xHis tag.
  • Description

    Recombinant Rubella Virus capsid protein (His tag)

Associated products

  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab256430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7
    Constituents: 0.32% Tris HCl, 0.29% Sodium chloride, 0.5% Sodium lauryl sulfate

    Sterile filtered.

    Removal of SDS will result in a concentration-dependent aggregation of the protein.

General Info

  • Alternative names

    • Coat protein
    • p110
    • rubella capsid
    • Structural polyprotein
  • Relevance

    Rubella virus is the only member of the Rubrivirus genus of the Togavirus family. Unlike most Togaviruses it is NOT arthropod borne, but is acquired via the respiratory route. It causes German measles ( a mild contagious eruptive disease, capable of producing congenital defects in infants born to mothers infected during the first three months of pregnancy). Rubella virus is an enveloped positive-strand RNA virus. The genome encodes two open reading frames (ORFs): the 5'-proximal ORF encodes viral nonstructural proteins (NSP) that are responsible for viral genome replication, while the 3'-proximal ORF encodes three virion structural proteins (SP), the capsid protein (CP), and the two envelope glycoproteins, E2 and E1. During virus assembly, the capsid interacts with genomic RNA to form nucleocapsids. The rubella virus (RV) structural proteins: capsid, E2, and E1 are synthesized as a polyprotein precursor. The signal peptide that initiates translocation of E2 into the lumen of the endoplasmic reticulum remains attached to the carboxy terminus of the capsid protein after cleavage by signal peptidase.
  • Cellular localization

    Cytoplasmic in host cells concentrated around Golgi region and mitochondrion.

Images

  • SDS-PAGE - Recombinant Rubella Virus capsid protein (ab256430)
    SDS-PAGE - Recombinant Rubella Virus capsid protein (ab256430)

    SDS-PAGE analysis of ab256430 under reducing conditions.

  • Functional Studies - Recombinant Rubella Virus capsid protein (ab256430)
    Functional Studies - Recombinant Rubella Virus capsid protein (ab256430)

    Detection of anti-Rubella IgG in human serum. 

    Plate coated with 50 ng/well of antigens. NP = ab256430

    Antigens coated in bicarbonate-carbonate buffer pH 9.6 for 1 hour at RT. Blocked with 2% BSA/PBS for 2 hours at RT.

    Washed x3 with Tris washing buffer.

    Serum samples (Public Health England) diluted 1/201 in 1% BSA in PBS-T.

    Secondary antibody was anti-Human-IgG-HRP diluted 1/10000 in 1% BSA in PBS-T. TMB detection.

     

  • Functional Studies - Recombinant Rubella Virus capsid protein (ab256430)
    Functional Studies - Recombinant Rubella Virus capsid protein (ab256430)

    Detection of anti-Rubella IgM in human serum. 

    Plate coated with 100 ng/well of antigens. NP = ab256430

    Washed x3 with Tris washing buffer.

    Serum samples (Public Health England) diluted 1/201 in 1% BSA in PBS-T + 4% IgG/RF stripper. After standing for 30 minutes the diluted samples were centrifuged at 17,000 x g for 1 minute and the supernatant used for ELISA.

    Secondary antibody was anti-Human-IgM-HRP diluted 1/10000 in 1% BSA in PBS-T. TMB detection.

     

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (0)

Publishing research using ab256430? Please let us know so that we can cite the reference in this datasheet.

ab256430 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab256430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.