Recombinant Rubella Virus capsid nucleoprotein protein (His tag) (ab256430)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant Rubella Virus capsid nucleoprotein protein (His tag)
See all Rubella Virus capsid proteins and peptides -
Purity
> 95 % SDS-PAGE.
Buffered in 20mM TRIS-HCl pH8.0, 50mM NaCl, 0.5% SDS. Purified from cell lysate. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rubella virus -
Sequence
MASTTPITMEDLQKALEAQSRALRAELAAGASQSRRPRPPRQRDSSTSGD DSGRDSGGPRRRRGNRGRGQRRDWSRAPPPPEERQETRSQTPAPKPSRAP PQQPQPPRMQTGRGGSAPRPELGPPTNPFQAAVARGLRPPLHDPDTEAPT EACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPE PPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVRGL DGDSAPLPPHTTERIETRSARHPWRIRFGAPQAFLAGLLLATVAVGTARA -
Amino acids
1 to 300 -
Tags
His tag C-Terminus -
Additional sequence information
NP_0628841.1. Strain F-Therien. C-terminal 10 amino acid Gly-Ser linker connecting the protein to a 6xHis tag.
-
-
Description
Recombinant Rubella Virus capsid protein (His tag)
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab256430 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7
Constituents: 0.32% Tris HCl, 0.29% Sodium chloride, 0.5% Sodium lauryl sulfate
Sterile filtered.
Removal of SDS will result in a concentration-dependent aggregation of the protein.
General Info
-
Alternative names
- Coat protein
- p110
- rubella capsid
- Structural polyprotein
-
Relevance
Rubella virus is the only member of the Rubrivirus genus of the Togavirus family. Unlike most Togaviruses it is NOT arthropod borne, but is acquired via the respiratory route. It causes German measles ( a mild contagious eruptive disease, capable of producing congenital defects in infants born to mothers infected during the first three months of pregnancy). Rubella virus is an enveloped positive-strand RNA virus. The genome encodes two open reading frames (ORFs): the 5'-proximal ORF encodes viral nonstructural proteins (NSP) that are responsible for viral genome replication, while the 3'-proximal ORF encodes three virion structural proteins (SP), the capsid protein (CP), and the two envelope glycoproteins, E2 and E1. During virus assembly, the capsid interacts with genomic RNA to form nucleocapsids. The rubella virus (RV) structural proteins: capsid, E2, and E1 are synthesized as a polyprotein precursor. The signal peptide that initiates translocation of E2 into the lumen of the endoplasmic reticulum remains attached to the carboxy terminus of the capsid protein after cleavage by signal peptidase. -
Cellular localization
Cytoplasmic in host cells concentrated around Golgi region and mitochondrion.
Images
-
SDS-PAGE analysis of ab256430 under reducing conditions.
-
Detection of anti-Rubella IgG in human serum.
Plate coated with 50 ng/well of antigens. NP = ab256430
Antigens coated in bicarbonate-carbonate buffer pH 9.6 for 1 hour at RT. Blocked with 2% BSA/PBS for 2 hours at RT.
Washed x3 with Tris washing buffer.
Serum samples (Public Health England) diluted 1/201 in 1% BSA in PBS-T.
Secondary antibody was anti-Human-IgG-HRP diluted 1/10000 in 1% BSA in PBS-T. TMB detection.
-
Detection of anti-Rubella IgM in human serum.
Plate coated with 100 ng/well of antigens. NP = ab256430
Washed x3 with Tris washing buffer.
Serum samples (Public Health England) diluted 1/201 in 1% BSA in PBS-T + 4% IgG/RF stripper. After standing for 30 minutes the diluted samples were centrifuged at 17,000 x g for 1 minute and the supernatant used for ELISA.
Secondary antibody was anti-Human-IgM-HRP diluted 1/10000 in 1% BSA in PBS-T. TMB detection.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab256430 has not yet been referenced specifically in any publications.