Recombinant S. cerevisiae Hsp90 co-chaperone AHA1 protein (His tag) (ab222785)

Description

  • Product name

    Recombinant S. cerevisiae Hsp90 co-chaperone AHA1 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.
    ab222785 was affinity purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Saccharomyces cerevisiae
    • Sequence

      MGHHHHHHMVVNNPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYA KIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGS INVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQF GKDLLATHGNDIQVPESQVKSNYTRGNQKSSFTEIKDSASKPKKNALPSS TSTSAPVSSTNKVPQNGSGNSTSIYLEPTFNVPSSELYETFLDKQRILAW TRSAQFFNSGPKLETKEKFELFGGNVISELVSCEKDKKLVFHWKLKDWSA PFNSTIEMTFHESQEFHETKLQVKWTGIPVGEEDRVRANFEEYYVRSIKL TFGFGAVL
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      1 to 350
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab222785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.20
    Constituents: 50% Glycerol, 0.3% HEPES, 0.06% Sodium chloride

General Info

  • Alternative names

    • Activator of Hsp90 ATPase protein 1
    • AHA1

Images

  • SDS-PAGE analysis of ab222785.

References

ab222785 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up