Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Saccharomyces cerevisiae
    • Sequence

      MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLE QHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGS APGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKW IYE
    • Molecular weight

      37 kDa including tags
    • Amino acids

      1 to 153
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Strain ATCC 204508 / S288c (Baker's yeast). N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab235793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • NDK
    • NDK_ECOLI
    • NDP kinase
    • Nucleoside diphosphate kinase
    • Nucleoside-2-P kinase
    see all
  • Function

    Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.
  • Sequence similarities

    Belongs to the NDK family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235793.

References

ab235793 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up