Description

  • Product name

    Recombinant S. cerevisiae Smt3 protein (His tag)
    See all Smt3 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Saccharomyces cerevisiae
    • Sequence

      SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEA FAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      2 to 98
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Strain ATCC 204508 / S288c) (Baker's yeast). This product is the mature full length protein from aa 2 to 98. The propeptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab241534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • DmSUMO 1
    • Small Ubiquitin-like modifier
    • SMT3
    • SMT3_YEAST
    • Ubiquitin like protein of the SUMO family
    • Ubiquitin like protein SMT3
    • Ubiquitin-like protein SMT3
    see all
  • Function

    Not known; suppressor of MIF2 mutations.
  • Sequence similarities

    Belongs to the ubiquitin family. SUMO subfamily.
    Contains 1 ubiquitin-like domain.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab241534.

References

ab241534 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241534.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up