Recombinant Salmonella heidelberg D-serine dehydratase (dsdA) protein (His tag) (ab225614)

Overview

  • Product name

    Recombinant Salmonella heidelberg D-serine dehydratase (dsdA) protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Salmonella heidelberg
    • Sequence

      MENIQKLIARYPLVEDLVALKETTWFNPGATSLAQGLPYVGLTEQDVNAA HDRLARFAPYLAKAFPQTAAAGGMIESDVVAIPAMQKRLEKEYGQTIDGE MLLKKDSHLAISGSIKARGGIYEVLTHAEKLALEAGLLTTDDDYSVLLSP EFKQFFSQYSIAVGSTGNLGLSIGIMSACIGFKVTVHMSADARAWKKAKL RSHGVTVVEYEDDYGVAVEQGRKAAQSDPNCFFIDDENSRTLFLGYAVAG QRLKAQFAQQGRVVDASHPLFVYLPCGVGGGPGGVAFGLKLAFGDNVHCF FAEPTHSPCMLLGVYTGLHDAISVQDIGIDNLTAADGLAVGRASGFVGRA MERLLDGLYTLDDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRICAAAA YQQRHGFSQTQLGNATHLVWATGGGMVPEDEMEQYLAKGR
    • Molecular weight

      63 kDa including tags
    • Amino acids

      1 to 440
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Salmonella heidelberg (strain SL476) protein with 6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab225614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • D serine deaminase
    • DSD
    • dsdA

Images

  • Discontinuous SDS-PAGE (Tris-Glycine gel) (reduced) analysis of ab225614 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab225614 could indicate that this peptide derived from E.coli-expressed Salmonella heidelberg (strain SL476) D-serine dehydratase (dsdA).

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab225614 could indicate that this peptide derived from E.coli-expressed Salmonella heidelberg (strain SL476) D-serine dehydratase (dsdA).

References

ab225614 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225614.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up