Recombinant Salmonella typhimurium D-galactose binding periplasmic protein (His tag) (ab226235)

Description

  • Product name

    Recombinant Salmonella typhimurium D-galactose binding periplasmic protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Salmonella typhimurium
    • Sequence

      ADTRIGVTIYKYDDNFMSVVRKAIEKDGKSAPDVQLLMNDSQNDQSKQND QIDVLLAKGVKALAINLVDPAAAGTVIEKARGQNVPVVFFNKEPSRKALD SYDKAYYVGTDSKESGVIQGDLIAKHWQANQGWDLNKDGKIQYVLLKGEP GHPDAEARTTYVVKELNDKGIQTEQLALDTAMWDTAQAKDKMDAWLSGPN ANKIEVVIANNDAMAMGAVEALKAHNKSSIPVFGVDALPEALALVKSGAM AGTVLNDANNQAKATFDLAKNLAEGKGAADGTSWKIENKIVRVPYVGVDK DNLSEFTQK
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      24 to 332
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Strain LT2 / SGSC1412 / ATCC 700720. This product is the mature full length protein from aa 24 to 332. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226235 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226235 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab226235 could indicate that this peptide derived from Yeast-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) D-galactose binding periplasmic protein.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab226235 could indicate that this peptide derived from Yeast-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) D-galactose binding periplasmic protein.

References

ab226235 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226235.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up