Recombinant Salmonella typhimurium PrgI protein (His tag) (ab237560)

Description

  • Product name

    Recombinant Salmonella typhimurium PrgI protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Salmonella typhimurium
    • Sequence

      MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSK LSEYNLYRNAQSNTVKVFKDIDAAIIQNFR
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      1 to 80
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Strain LT2 / SGSC1412 / ATCC 700720. N-terminal 6xHis-SUMO-tag.

Specifications

Our Abpromise guarantee covers the use of ab237560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab237560.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab237560 could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) prgI.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab237560 could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) prgI.

References

ab237560 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up