Description

  • Product name

    Recombinant Serine/threonine-protein phosphatase
  • Biological activity

    400,000 U/mg. 400 U/µl, where one unit is defined as the amount of enzyme that hydrolyzes 1 nmole of p-nitrophenyl phosphate per minute at 30°C. Unit definition assays are performed with 50mM p-nitrophenyl phosphate in λ-PPase buffer, supplemented with 2 mM MnCl2 in a 50 µl reaction.

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Bacteriophage lambda
    • Sequence

      MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDL VDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGW FFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFG KPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMY IDTGAVFCGNLTLIQVQGEGA
    • Predicted molecular weight

      25 kDa
    • Amino acids

      1 to 221
    • Additional sequence information

      From Bacteriophage lambda

Specifications

Our Abpromise guarantee covers the use of ab188459 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab188459 can be used to release phosphate groups from phosphorylated serine, threonine, tyrosine and histidine residues in proteins

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 1.19% HEPES, 0.58% Sodium chloride, 0.03% DTT, 0.001% Manganese chloride, 0.002% EDTA, 50% Glycerol, 0.01% Brij

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

Images

  • NPM1 protein in HeLa cells treated with Nocodazole was lyzed, and immunoprecipited with ab188459. The precipitate was suspended in 50 μl of

    λ protein phosphatase reaction buffer, with 5 μl of the protein phosphatase and incubated at 30℃. The reaction products were analyzed by western blotting.

  • SDS-PAGE analysis of ab188459.

References

ab188459 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188459.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up