Description

  • Product name

    Recombinant Sheep CCL4/MIP-1 beta protein
    See all CCL4/MIP-1 beta proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab208819 was purified by Ion-exchange chromatography.
  • Expression system

    Yeast
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Sheep
    • Sequence

      APMGSDPPTACCFSYTLRQIPRNFVIDYYETSSLCSQPAVVFQTKKGRQV CANPSEPWVQEYMDDLELN
    • Predicted molecular weight

      8 kDa
    • Amino acids

      24 to 92

Specifications

Our Abpromise guarantee covers the use of ab208819 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab208819 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

     This product was previously labelled as Macrophage Inflammatory Protein 1 beta, MIP1 beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Trehalose

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • MIP 1 beta
    • Secreted protein G 26
    • ACT 2
    • ACT-2
    • ACT2
    • AT744.1
    • AT744.2
    • C C motif chemokine 4
    • C C motif chemokine 4 like
    • C C motif chemokine ligand 4 like 1
    • C C motif chemokine ligand 4 like 2
    • CC chemokine ligand 4
    • CC chemokine ligand 4L1
    • CC chemokine ligand 4L1d2
    • CC chemokine ligand 4L2
    • CCL4
    • CCL4_HUMAN
    • CCL4L
    • ccl4l 1
    • CCL4L1
    • Chemokine (C C motif) ligand 4
    • Chemokine (C C motif) ligand 4 like 1
    • Chemokine (C C motif) ligand 4 like 1, telomeric
    • Chemokine (C C motif) ligand 4 like 2
    • Chemokine CC Motif Ligand 4
    • G 26
    • G 26 T lymphocyte secreted protein
    • G-26 T-lymphocyte-secreted protein
    • HC21
    • Immune activation 2
    • LAG 1
    • LAG-1
    • LAG1
    • Lymphocyte activation gene 1
    • Lymphocyte activation gene 1 protein
    • Macrophage inflammatory protein 1 beta
    • Macrophage inflammatory protein 1-beta
    • Macrophage inflammatory protein 1b2
    • MGC104418
    • MGC126025
    • MGC126026
    • MIP-1-beta
    • MIP-1-beta(1-69)
    • MIP-1-beta(3-69)
    • MIP1 beta
    • MIP1B
    • MIP1B1
    • Monocyte adherence induced protein 5 alpha
    • PAT 744
    • Protein H400
    • SCYA2
    • SCYA4
    • SCYA4L
    • SCYA4L1
    • SCYA4L2
    • SCYQ4L2
    • Secreted protein G 26
    • Secreted protein G26
    • SIS gamma
    • SIS-gamma
    • Small inducible cytokine A4
    • Small inducible cytokine A4 (homologous to mouse Mip 1b)
    • small inducible cytokine A4-like
    • Small-inducible cytokine A4
    • T cell activation protein 2
    • T-cell activation protein 2
    see all
  • Function

    Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab208819 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208819.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up