Description

  • Product name

    Recombinant Sheep IL-17A protein
    See all IL-17A proteins and peptides
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Sheep
    • Sequence

      GVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRNTNSRRPTDYHKRSTSPWT LHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRE SQHCPHSFRLEKMLVAVGCTCVTPIVRHVA
    • Predicted molecular weight

      15 kDa
    • Amino acids

      24 to 153
    • Additional sequence information

      Full length chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab189241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Lyophilised
  • Additional notes

    Endotoxin-free, suitable for cell culture.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • CTLA 8
    • CTLA-8
    • CTLA8
    • cytotoxic T lymphocyte associated antigen 8
    • Cytotoxic T lymphocyte associated protein 8
    • Cytotoxic T lymphocyte associated serine esterase 8
    • Cytotoxic T-lymphocyte-associated antigen 8
    • IL 17
    • IL 17A
    • IL-17
    • IL-17A
    • IL17
    • IL17_HUMAN
    • Il17a
    • Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8)
    • interleukin 17A
    • Interleukin-17A
    • interleukin17
    • Interleukin17A
    • OTTHUMP00000016597
    • OTTMUSP00000046003
    see all
  • Function

    Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts.
  • Tissue specificity

    Restricted to activated memory T-cells.
  • Sequence similarities

    Belongs to the IL-17 family.
  • Post-translational
    modifications

    Found both in glycosylated and nonglycosylated forms.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab189241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up