Description

  • Product name

    Recombinant Simian Virus 40 (SV40) SV40 Large T Antigen protein
  • Purity

    > 95 % Affinity purified.
    ab82118 is greater than 95% homogeneous based on SDS-PAGE analysis, purified by affinity and FPLC chromatography.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Simian Virus 40
    • Sequence

      MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEE KMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNE ENLFCSEEMPSSDDEATADSQHSTPPKKKRKVEDPKDFPSELLSFLSHAV FSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTP HRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPG GLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFE MCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRV DSLQLTREQMLTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPK MDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNV NLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDY LDGSVKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQARFVKQIDFRAK DYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK ERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNED GGEKNMEDSGHETGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKK PPTPPPEPET
    • Amino acids

      1 to 708
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab82118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.75% Potassium chloride, 0.0154% DTT, 0.316% Tris HCl, 0.00584% EDTA, 20% Glycerol

General Info

  • Alternative names

    • Large T antigen
    • LT
    • LTAG
    • Simian virus 40
  • Relevance

    SV40 T antigen is encoded by the early region of the SV40 genome. The large T antigen binds DNA, and complexes with a 53,000 dalton cellular protein, p53, which is required for initiation of viral DNA replication during lytic growth. In addition the large T antigen binds DNA polymerase and the transcription factor AP2 and forms a specific complex with the P105 product of the retinoblastoma susceptibility gene.
  • Cellular localization

    Host nucleus

References

ab82118 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab82118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up