Description

  • Product name

    Recombinant Sortase A protein (His tag)
  • Purity

    >= 87 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Bacteria
    • Sequence

      MHHHHHHKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKD KSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIA GHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGV LDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      26 to 206
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Species: Staphylococcus aureus. GenBank Accession No. AF162687.

Specifications

Our Abpromise guarantee covers the use of ab198443 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 0.05% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

General Info

  • Alternative names

    • LPXTG specific sortase A
    • sortase
    • Srt A
    • SrtA
    • STAA3
    • STAAU
    see all
  • Relevance

    Sortase was the first member of a novel family of cell surface, membrane anchored transpeptidases identified from Staphylcoccus aureus. It is involved in the processing, presentation and attachment of key cell surface proteins such as protein A to the peptidoglycan of the bacterial cell wall. Inhibition of SrtA has resulted in reduced adhesive properties of this pathogen and represents a target for the development of novel anti-bacterials.
  • Cellular localization

    Anchored to cell Membrane

Images

  • 4-20% SDS-PAGE analysis of 0.9 µg ab198443 with Coomassie staining.

References

This product has been referenced in:

  • Thay B  et al. Aggregatibacter actinomycetemcomitans outer membrane vesicles are internalized in human host cells and trigger NOD1- and NOD2-dependent NF-?B activation. Infect Immun 82:4034-46 (2014). Read more (PubMed: 25024364) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198443.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up