Recombinant Soybean 2S albumin protein (His tag) (ab241227)

Description

  • Product name

    Recombinant Soybean 2S albumin protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Soybean
    • Sequence

      SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTM RGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQ SEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      22 to 158
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the full length protein from aa 22 to 158 including the propeptide. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab241227 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab241227.

References

ab241227 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241227.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up