Description

  • Product name

    Recombinant Soybean p34 protein
  • Purity

    > 95 % SDS-PAGE.
    ab73805 is purified by proprietary chromatographic technique. Purity is >95% pure as determined by 10% PAGE (coomassie staining) and RP-HPLC.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Soybean
    • Sequence

      MGFLVLLLFSLLGLSSSSSISTHRSILDLDLTKFTTQKQVSSLFQLWKSE HGRVYHNHEE EAKRLEIFKNNLNYIRDMNANRKSPHSHRLGLNKFADI TPQEFSKKYLQAPKDVSQQIKM ANKKMKKEQYSCDHPPASWDWRKKGV ITQVKYQGGCGSGWAFSATGAIEAAHAIATGDLV SLSEQELVDCVEES EGCYNGWHYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVT ID GYETLIMSDESTESETEQAFLSAILEQPISVSIDAKDFHLYTGGIYDGEN CTSPYGIN HFVLLVGYGSADGVDYWIAKNSWGEDWGEDGYIWIQRNTG NLLGVCGMNYFASYPTKEES ETLVSARVKGHRRVDHSPL
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      1 to 379
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab73805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.

    pH: 8.00
    Constituents: 0.307% Glutathione, 0.79% Tris HCl, 50% Glycerol, 0.348% Sodium chloride

General Info

  • Alternative names

    • 34 kDa maturing seed vacuolar thiol protease precursor
    • LOC548062
    • P34 probable thiol protease
  • Relevance

    p34 belongs to the peptidase C1 family and is probably a thiol protease.
  • Cellular localization

    Vacuole.

References

ab73805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

ab73805 is a Soybean P34 full length protein. The protein is fused to a His tag at C-terminus. The molecular weight of this protein should be 43 kDa in theory however, we observe a molecular weight of 30kDa in our Hepes buffer system.


ab73805 corresponds to amino acids 214-261 and 351-379 only and is fused to GST at N-terminus. This is a single polypeptide consisting of ˜70 amino acids and it's molecular weight is ˜36 kDa.

Read More

Question
Answer

Thank you for contacting Abcam about ab73805. The laboratory has informed that the E.Coli derived recombinant protein contains only the Soybean P34 protein epitopes 214-261, 351-379 amino acids. The protein is fused to a GST tag at N-terminus. If there is anything else I can help you with, please let me know.      

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up