Description

  • Product name

    Recombinant Soybean RUBISCO protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Soybean
    • Sequence

      PQTETKASVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEE AGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGLEPVAGEENQYIAYVA YPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYIKTFQGPP HGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKD DENVNSQPFMRWRDRFLFCAEAIFKSQAETGEIKGHYLNATAGTCEEMMK RAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAVID RQKNHGMHFRVLAKALRLSGGDHVHAGTVVGKLEGEREITLGFVDLLRDD FVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQF GGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNEIIREASKWS PELAAACEVWKEIKFEFEAMDTL
    • Predicted molecular weight

      68 kDa including tags
    • Amino acids

      3 to 475
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 3 to 475. The propeptide is not included. N-terminal 6xHis-SUMO-tag.

Specifications

Our Abpromise guarantee covers the use of ab236166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 3 phospho D glycerate carboxylase
    • rbcL
    • RBL_SPIOL
    • Ribulose 1,5 bisphosphate carboxylase/oxygenase small subunit N methyltransferase I
    • Ribulose bisphosphate carboxylase large chain
    • RuBisCO large subunit
    see all
  • Function

    RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate in the photorespiration process. Both reactions occur simultaneously and in competition at the same active site.
  • Sequence similarities

    Belongs to the RuBisCO large chain family. Type I subfamily.
  • Post-translational
    modifications

    The disulfide bond which can form between Cys-247 in the large chain dimeric partners within the hexadecamer appears to be associated with oxidative stress and protein turnover (By similarity). The disulfide bonds reported in 1RBO may be the result of oxidation during crystallization.
  • Cellular localization

    Plastid > chloroplast.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236166.

References

ab236166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up