Recombinant Spike glycoprotein (His tag) (ab235851)

Description

  • Product name

    Recombinant Spike glycoprotein (His tag)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCN NIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAT SCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVY AQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCH NAAQCNCLCTPDPIT
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      326 to 540
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Bovine coronavirus (strain Mebus) (BCoV) (BCV). N-terminal 10xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • ab235851 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235851 could indicate that this peptide derived from E.coli-expressed Bovine coronavirus (strain Mebus) Spike glycoprotein.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235851 could indicate that this peptide derived from E.coli-expressed Bovine coronavirus (strain Mebus) Spike glycoprotein.

References

ab235851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up