Overview

  • Product name

    Recombinant Staphylococcus aureus CHIPS protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Yeast
  • Amino Acid Sequence
    • Accession
    • Species

      Staphylococcus aureus
    • Sequence

      FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLK KGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFK KGESKSSYVINGPGKTNEYAY
    • Molecular weight

      16 kDa including tags
    • Amino acids

      29 to 149
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Staphylococcus aureus (strain MRSA252) full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab226270 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Chemotaxis inhibiting protein
    • Chemotaxis inhibitory protein
  • Relevance

    The bacterial pathogen Staphylococcus aureus is insensitive to antimicriobial host defense peptides like defensins, protegrins, platelet microbicidial proteins and bacteriocins. Staphylococci have developed various resistance mechanisms including those specific for bacteriocins and several host defence peptides. A protein belonging to the resistance mechanism of Staphylococcus aureus is known as CHIPS ( Chemotaxis Inhibiting Protein for Staphylococcus aureus). CHIPS is a proteins that inhibits chemotaxis of neutrophils by blocking the Formyl Peptide Receptor (FPR) and C5a Receptor on neutrophils.
  • Cellular localization

    Secreted

Images

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab226270 could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain MRSA252) chp.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab226270 could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain MRSA252) chp.

References

ab226270 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226270.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up