Recombinant Staphylococcus aureus Enterotoxin C2 protein (ab225567)

Description

  • Product name

    Recombinant Staphylococcus aureus Enterotoxin C2 protein
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Staphylococcus aureus
    • Sequence

      ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLI YNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDN VGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTD KKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDM MPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
    • Predicted molecular weight

      28 kDa
    • Amino acids

      28 to 266
    • Additional sequence information

      This product is the mature full length protein from aa 28 to 266. The signal peptide is not included.
  • Description

    Recombinant Staphylococcus aureus Staphylococcus Enterotoxin C2 protein

Specifications

Our Abpromise guarantee covers the use of ab225567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • entC2
    • Enterotoxin type C 2
    • SEC2

References

ab225567 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
ELISA
Staphylococcal enterotoxin C2, ab225567, can be used as a positive control in ELISA. The linear range with RIDASCREEN SET A,B,C,D,E (r-biopharm) was 0.25 - 1 ng/ml.

Abcam user community

Verified customer

Submitted Jan 21 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up