Description

  • Product name

    Recombinant staphylococcus aureus hlgB protein (Active)
    See all hlgB proteins and peptides
  • Biological activity

    Cytotoxicity can be detected in human neutrophils when used in combination with hIg A or hlg C.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Staphylococcus aureus
    • Sequence

      MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTAT ADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFS KLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISI SNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNN GWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPE FLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTF KSTYEIDWENHKVKLLDTKETENNK
    • Predicted molecular weight

      35 kDa
    • Amino acids

      1 to 325

Specifications

Our Abpromise guarantee covers the use of ab233597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Can be stored at -20°C for 2-3 weeks.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Constituent: PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Gamma hemolysin component B
    • H gamma 1
    • H gamma I
  • Relevance

    Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity.

Images

  • HL-60 (Human promyelocytic leukemia cell line) was differentiated into neutrophils by treatments with DMSO. Neutrophils were incubated with serial dilutions of rhIg A and rhIg B at equimolar concentration for 3 hours at 37°C with 5% CO2 and 95% humidity. Cellular viability was determined by adding XTT and incubation for additional 16 hours. Cells were centrifuged and the OD determined in the supernatants at 470/690 nm. Cells only represented by green circles.

    EC50 value was found to be 1.10 nM for ab233597 in combination with hIgA.

  • All lanes : Anti-hIgGB polyclonal antibody at 0.5 µg/ml

    Lane 1 : Recombinant staphylococcus aureus hlgB protein (Active) (ab233597) at 0.2 µg/ml
    Lane 2 : Recombinant staphylococcus aureus hlgB protein (Active) (ab233597) at 0.1 µg/ml
    Lane 3 : Recombinant staphylococcus aureus hlgB protein (Active) (ab233597) at 0.05 µg/ml
    Lane 4 : Recombinant staphylococcus aureus hlgB protein (Active) (ab233597) at 0.025 µg/ml

    Secondary
    All lanes : Anti-rabbit IgG-HRP


    TMB substrate

  • SDS-PAGE - Recombinant staphylococcus aureus hlgB protein (Active) (ab233597)

    Lane 1: ab233597 at 1 µg.

    Lane 2: ab233597 at 5 µg.

    Denaturing and reducing conditions.

     

References

ab233597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up