Description

  • Product name

    Recombinant Staphylococcus aureus hlgB protein (His tag)
    See all hlgB proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Staphylococcus aureus
    • Sequence

      AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKD TLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDY APKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESY RTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQS SAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREM DLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      26 to 325
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the full-length mature protein from aa 26 to 325. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab225605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Gamma hemolysin component B
    • H gamma 1
    • H gamma I
  • Relevance

    Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225605 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab225605 could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) hlgB protein.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab225605 could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) hlgB protein.

References

ab225605 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up