Recombinant staphylococcus aureus hlgC protein (Active) (ab233606)

Description

  • Product name

    Recombinant staphylococcus aureus hlgC protein (Active)
  • Biological activity

    Cytotoxicity can be detected in human neutrophils when used in combination with hIg B in a concentration range of 0.03-200 nM.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Staphylococcus aureus
    • Sequence

      ANDTEDIGKGSDIEIIKRTEDKTSNKWGVTQNIQFDFVKDKKYNKDALIL KMQGFISSRTTYYNYKKTNHVKAMRWPFQYNIGLKTNDKYVSLINYLPKN KIESTNVSQTLGYNIGGNFQSAPSLGGNGSFNYSKSISYTQQNYVSEVEQ QNSKSVLWGVKANSFATESGQKSAFDSDLFVGYKPHSKDPRDYFVPDSEL PPLVQSGFNPSFIATVSHEKGSSDTSEFEITYGRNMDVTHAIKRSTHYGN SYLDGHRVHNAFVNRNYTVKYEVNWKTHEIKVKGQN
    • Predicted molecular weight

      33 kDa
    • Amino acids

      30 to 315
    • Additional sequence information

      This product is the mature full length protein from aa 32 to 315. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab233606 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    This protein is derived from a pathogenic organism, and may be involved in a disease process, consequently exposure may have adverse health effects.

    Staphylococcus aureus.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Constituents: PBS, 5% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

Images

  • HL-60 (Human promyelocytic leukemia cell line) was differentiated into neutrophils by treatment with DMSO. Neutrophils were incubated with serial dilutions of hlg B tag-free and ab233606 at equimolar concentration for 3 hours at 37°C with 5% CO2 and 95% humidity. Cellular viability was determined by adding XTT and incubation for additional 16 hours.  OD’s were determined in the supernatants at 470/690 nm. Red squares represent (ab233606) and blue squares represent  hIgC his-tag. EC50 was found to be 2.84 nM for ab233606 and 5.53 nM for hIgC his-tag.

  • All lanes : Polyclonal hIgC antibody at 0.5 µg/ml

    Lane 1 : Recombinant staphylococcus aureus hlgC protein (Active) (ab233606) at 0.1 µg
    Lane 2 : Recombinant staphylococcus aureus hlgC protein (Active) (ab233606) at 0.05 µg
    Lane 3 : Recombinant staphylococcus aureus hlgC protein (Active) (ab233606) at 0.025 µg

    Secondary
    All lanes : Anti-rabbit IgG-horseradish peroxidase (HRP) conjugate


    TMB substrate

  • SDS-PAGE analysis of ab233606 under denaturing and reducing conditions.

    Lane 1: 1 µg

    Lane 2: 5 µg

References

ab233606 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233606.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up